Identification of the growth hormone‐releasing hormone analogue [Pro1, Val14]‐hGHRH with an incomplete C‐term amidation in a confiscated product. Issue 11 (6th October 2014)

• Record Type: Journal Article
• Authors: Esposito, Simone; Deventer, Koen; Van Eenoo, Peter
• Is Part Of: Drug testing and analysis. Volume 6:Issue 11/12(2014)
• Page Start: 1155
• Page End: 1159
• Publication Date: 2014-10-06
• Subjects: Drugs -- Analysis -- Periodicals; Drug testing -- Periodicals; Chemistry, Forensic -- Periodicals; 615.1901
• DOI: 10.1002/dta.1730
• Languages: English
• ISSNs: 1942-7603

Abstract

<abstract abstract-type="main"> <title> <x xml:space="preserve">Abstract</x> </title> <p>In this work, a modified version of the 44 amino acid human growth hormone‐releasing hormone (hGHRH(1‐44)) containing an N‐terminal proline extension, a valine residue in position 14, and a C‐terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL‐NH₂) has been identified in a confiscated product by liquid chromatography‐high resolution mass spectrometry (LC‐HRMS). Investigation of the product suggests also an incomplete C‐term amidation.</p> <p>Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance‐enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well. Copyright © 2014 John Wiley &amp; Sons, Ltd.</p> </abstract>